PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG045524t2
Common NameTCM_045524
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 366aa    MW: 39585.9 Da    PI: 6.3565
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG045524t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.61.7e-10164212553
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                       kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +
  Thecc1EG045524t2 164 KRAKRIIANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQ 212
                       9****************************************99887655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-16160224IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.599162225IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.1E-9164218No hitNo description
PfamPF001703.2E-9164212IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.7E-11164215No hitNo description
CDDcd147032.44E-24165214No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MPDPPSLSPN PDQPIHSNAS STTQTTPSFA NPTTFRGSYH RRAQSEVQFR IPDDLDLVSD  60
PFEGLGSEDD LFCSYMDIEK LGGSSKGADE GGAAGSSSAG SGQNPKGGEE TSGGSGMGEK  120
STGGGKGRHR YSNSVDGCSM MESIEAKKAM APDKLAELWT VDPKRAKRII ANRQSAARSK  180
ERKARYISEL ERKVQTLQTE ATTLSAQLTL FQRDTTGLST ENTELKLRLQ AMEQQAQLRD  240
ALNEALKKEV ERLKIATGEM TTPTDTFNLG MHHIPYTQSS YFPPQPQHVQ VDTHNIQMPQ  300
FHPFQSNMLT PNQSVVAASN SHAYADMMQQ DPLGRLQGLD ISSRGSRLVK SEGPSISAGE  360
HGGTL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007011316.10.0Basic-leucine zipper transcription factor family protein isoform 2
SwissprotQ6S4P41e-106RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A061FSP50.0A0A061FSP5_THECC; Basic-leucine zipper transcription factor family protein isoform 2
STRINGVIT_13s0067g02900.t011e-155(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-118bZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]